PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof018372
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family DBB
Protein Properties Length: 159aa    MW: 17083 Da    PI: 7.5741
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17328508PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.36.6e-08446541
   zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                C+ +e   ++  C  ++  lC+ C +e+H        H++ p
  Sof018372  4 QCDACEGAAATVVCCADEAALCARCDVEIHAAnklaskHQRLP 46
               7******99*********************6678888898877 PP

2zf-B_box26.51.3e-085486234
   zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeH 34
               + ++C+ ++ek + +fC +++ l+C+dC +  H
  Sof018372 54 KLPRCDVCQEKAAFIFCVEDRALFCRDCDEPVH 86
               5799************************99877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.011147IPR000315B-box-type zinc finger
CDDcd000212.60E-5347No hitNo description
SMARTSM003362.1E-9447IPR000315B-box-type zinc finger
PfamPF006435.1E-6447IPR000315B-box-type zinc finger
SMARTSM003364.5E-1453100IPR000315B-box-type zinc finger
PROSITE profilePS501199.27153100IPR000315B-box-type zinc finger
PfamPF006438.1E-75496IPR000315B-box-type zinc finger
CDDcd000212.67E-65686No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MKIQCDACEG AAATVVCCAD EAALCARCDV EIHAANKLAS KHQRLPLEAL SATKLPRCDV  60
CQEKAAFIFC VEDRALFCRD CDEPVHVPGT LFGNHQRYLA TGIRVGFASA SACSDGACDA  120
PRTPDHHRPR LKANRLEPTP LXNAPXRFSG PAGGQARGW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.106330.0callus| crown| inflorescence| leaf| meristem| seed| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002454143.16e-76hypothetical protein SORBIDRAFT_04g025400
SwissprotQ962882e-54BBX24_ARATH; B-box zinc finger protein 24
TrEMBLC5XX807e-76C5XX80_SORBI; Putative uncharacterized protein Sb04g025400
STRINGSb04g025400.12e-75(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06040.23e-56DBB family protein